PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G17710.1
Common Namedl4890c, FCAALL.102, HDG4, HDGL2-4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HD-ZIP
Protein Properties Length: 709aa    MW: 79277.3 Da    PI: 6.6254
Description homeodomain GLABROUS 4
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G17710.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.71.9e-1889144156
                  TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  +++ +++t++q++++e+lF++n +p++++r +L+kklgL+  qVk+WFqN+R++ k
  AT4G17710.1  89 KKRYHRHTASQIQQMEALFKENAHPDTKTRLRLSKKLGLSPIQVKFWFQNKRTQIK 144
                  688999**********************************************9877 PP

2START137.61.3e-432384631206
                  HHHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS............SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEE CS
        START   1 elaeeaaqelvkkalaeepgWvkssesengdevlqkfeeskv...........dsgealrasgvvdmvlallveellddkeqWdetla....kaetle 83 
                  ela ++a+el k+ + +ep+W k +  +n+ ++l ++e +k            ++ ea+ra +v   ++ +lv+ +ld   +W+e++     +a+t +
  AT4G17710.1 238 ELAVSCARELAKMCDINEPLWNKKR-LDNESVCLNEEEYKKMflwplmndddrFRREASRANAVIMLNCITLVKAFLDAD-KWSEMFFpivsSAKTAQ 333
                  578899******************9.6777777777777777999999**9999**************************.******99999****** PP

                  EECTT.....EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE..TTS-EEEEEEEEE-TTS--...-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE- CS
        START  84 vissg.....galqlmvaelqalsplvp.RdfvfvRyirq.lgagdwvivdvSvdseqkppe..sssvvRaellpSgiliepksnghskvtwvehvdl 172
                   issg     g+l lm+aelq+ splvp R+ +f+Ry +q  ++g+w++vd  +d  ++ +   + ++ R    pSg++i+ + ng+s+vtwvehv++
  AT4G17710.1 334 IISSGasgpsGTLLLMFAELQVVSPLVPtREAYFLRYVEQnAEEGKWMVVDFPIDRIKPASAttTDQYRR---KPSGCIIQAMRNGYSQVTWVEHVEV 428
                  ***************************************************9999888777554566666...************************* PP

                  -SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
        START 173 kgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                  +++++ ++++r +v+sg+a+ga +w++ l+rqce+
  AT4G17710.1 429 EEKHVqDEVVREFVESGVAFGAERWLSVLKRQCER 463
                  *****99**************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-1864148IPR009057Homeodomain-like
SuperFamilySSF466893.26E-1871147IPR009057Homeodomain-like
PROSITE profilePS5007116.16386146IPR001356Homeobox domain
SMARTSM003894.5E-1787150IPR001356Homeobox domain
PfamPF000465.9E-1689144IPR001356Homeobox domain
CDDcd000861.03E-1589147No hitNo description
PROSITE patternPS000270121144IPR017970Homeobox, conserved site
PROSITE profilePS5084840.016229466IPR002913START domain
SuperFamilySSF559611.13E-26231465No hitNo description
CDDcd088753.34E-105233462No hitNo description
SMARTSM002348.0E-25238463IPR002913START domain
PfamPF018522.5E-36239463IPR002913START domain
SuperFamilySSF559611.65E-6483669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009046anatomyflower
Sequence ? help Back to Top
Protein Sequence    Length: 709 aa     Download sequence    Send to blast
METKDKKEKG HMVLNSDNVF GSVSSSPTTT IQNPNYFTSF ENPNFPYIFP KEEYEVMSKI  60
ESGSGKSTGS GHDPVENTAI EQEPPAAKKK RYHRHTASQI QQMEALFKEN AHPDTKTRLR  120
LSKKLGLSPI QVKFWFQNKR TQIKAQQSRS DNAKLKAENE TLKTESQNIQ SNFQCLFCST  180
CGHNLRLENA RLRQELDRLR SIVSMRNPSP SQEITPETNK NNNDNMLIAE EEKAIDMELA  240
VSCARELAKM CDINEPLWNK KRLDNESVCL NEEEYKKMFL WPLMNDDDRF RREASRANAV  300
IMLNCITLVK AFLDADKWSE MFFPIVSSAK TAQIISSGAS GPSGTLLLMF AELQVVSPLV  360
PTREAYFLRY VEQNAEEGKW MVVDFPIDRI KPASATTTDQ YRRKPSGCII QAMRNGYSQV  420
TWVEHVEVEE KHVQDEVVRE FVESGVAFGA ERWLSVLKRQ CERMASLMAT NITDLGVIPS  480
VEARKNLMKL SQRMVKTFCL NIINSHGQAP TKDTVKIVSR KVCGGLVPCA VSVTLLPYSH  540
QQVFDLLRDN QRLSQLEILF MGSSFQEVAH IANGSHLGNS ISLLRINVES NSSHNVELML  600
QETCTDNSGS LLVYSTVDPV AVQLAMNGED PSEIPLLPVG FSVVPVNPSD GVEGSSVSSP  660
SCLLTVAIQV LGSNVTTERL DLSTVSVINH RICATVNRIT SALVNDVGN
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306841540.0
Genevisible245378_at0.0
Expression AtlasAT4G17710-
AtGenExpressAT4G17710-
ATTED-IIAT4G17710-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in flowers. {ECO:0000269|PubMed:16778018}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a homeobox-leucine zipper family protein belonging to the HD-ZIP IV family.
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G17710.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G73360
IntActSearch Q8L7H4
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G17710
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1337000.0AY133700.1 Arabidopsis thaliana clone C103238 putative GLABRA2 protein (At4g17710) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_193506.20.0homeobox-leucine zipper protein HDG4
SwissprotQ8L7H40.0HDG4_ARATH; Homeobox-leucine zipper protein HDG4
TrEMBLR0GP440.0R0GP44_9BRAS; Uncharacterized protein
STRINGAT4G17710.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM43562548
Representative plantOGRP14515136
Publications ? help Back to Top
  1. Tavares R,Aubourg S,Lecharny A,Kreis M
    Organization and structural evolution of four multigene families in Arabidopsis thaliana: AtLCAD, AtLGT, AtMYST and AtHD-GL2.
    Plant Mol. Biol., 2000. 42(5): p. 703-17
    [PMID:10809443]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  4. Schrick K,Nguyen D,Karlowski WM,Mayer KF
    START lipid/sterol-binding domains are amplified in plants and are predominantly associated with homeodomain transcription factors.
    Genome Biol., 2004. 5(6): p. R41
    [PMID:15186492]
  5. Nakamura M, et al.
    Characterization of the class IV homeodomain-Leucine Zipper gene family in Arabidopsis.
    Plant Physiol., 2006. 141(4): p. 1363-75
    [PMID:16778018]
  6. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]